(eIF4A)-aptamer
Description
In 2003, Oguro et al. generated the RNA aptamers 4Apt with high affinity for human translation initiation factor 4A (eIF4A) by SELEX, then confirming the secondary structure. Then in 2005, Sakamoto et al. determined the solution structure of two essential nucleotide loops (AUCGCA and ACAUAGA) within the aptamer 4Apt using NMR spectroscopy, and proposed that the AUCGCA loop is directly involved in the interaction with eIF4A[1,2].SELEX
In 2003, Oguro et al. generated the RNA aptamers 4Apt with high affinity for human translation initiation factor 4A (eIF4A) by SELEX[1].
Detailed information are accessible on SELEX page.
Structure
2D representation
In the previous SELEX experiment, Aptamer no. 21 was islated. Aptamer no. 21 showed highest binding affinity to eIF4A among the selected aptamers, the 58 nt core structure of this aptamer is required for efficient recognition of eIF4A. Furthermore, the aptamer binds only to an intact eIF4A, and not to either domain when split at the linker of the ‘dumbbell’ structure. APT58 (58 nt long), a variant of the aptamer no. 21 core structure that sustained 4 nt substitutions (G3→A, C6→U, G10→A and C12→U) for NMR analysis[2].
5'-GGAGAUCGCACUCCACAUGUGAGUGAGGCCGAAACAUAGAUUCGACAGGAGGCUCACA-3'
3D visualisation
Sakamoto et al. determined the solution structure of two essential nucleotide loops (AUCGCA and ACAUAGA) within the aptamer APT58 aptamer using NMR spectroscopy, suggesting that the C7 and C9 of the AUCGCA loop directly interact with eIF4A. Due to the lack of complex structure of 4Apt aptamer and eIF4A. In the AUCGCA loop, C7 and C9 are mrked for the directly interacted bases, while ACCGCA loop forms a similar conformation to U-turn motif and that the U-turn like conformation could be important for eIF4A binding without directly interacted bases[2].Additional available structures that have been solved and detailed information are accessible on Structures page.
(Clicking the "Settings/Controls info" to turn Spin off)
|
|
Binding pocket
Due to the lack of complex structure of APT58 aptamer and eIF4A. Sakamoto, T. Through experiments, it is proved that C7 and C9 are related to the binding of eIF4A. Left: in the tertiary structure, it's labeled C7, C9 in purple. Right: eIF4A (shown in vacuumm electrostatics), blue is positive charge, red is negative charge.
|
|
Ligand information
SELEX ligand
Oguro et al. used 40N and 30N to perform the in vitro RNA selection, which represented 40 and 30 random nucleotide positions, respectively[1].
Name | Sequence | Ligand | Affinity |
---|---|---|---|
RNA no.1 | 5′-CAGGCGUUUAGCCUCUAAGUAACAGGGGGCCUCCCAUGAGC-3′ | mammalian translation initiation factor 4A | 3μM |
RNA no.11 | 5′-ACAUUGCAUCGACAGCUGCAAGGCUCCCGCCGUACAAACC *5-3′ | mammalian translation initiation factor 4A | 8μM |
RNA no.20 | 5′-GGGGACCGCGCCCCACAUGUGAGUGAGGCCGAAACGUAGA *28-3′ | mammalian translation initiation factor 4A | 40nM |
RNA no.21 | 5′-GGGGACCGCGCCCCACAUGUGAGUGAGGCCGAAACAUAGA-3′ | mammalian translation initiation factor 4A | 27nM |
RNA no.30 | 5′-UGUGGAUGAUUUGUAUGAUCGCGCAUACAA *5-3′ | mammalian translation initiation factor 4A | 1μM |
Structure ligand
ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.-----Pfam
Uniprot ID | Pfam | MW | Amino acids sequences | PDB ID | GenBank |
---|---|---|---|---|---|
P10081 | P10081 | 44.70kDa | SEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN | 1FUU | 559292 |
Similar compound
We used the Dail server website to compare the structural similarities of ligand proteins, and selected the previous information with high similarity for presentation. The Dali server is a network service for comparing protein structures in 3D. Dali compares them against those in the Protein Data Bank (PDB).
PDB | Z-score | RMSD | Description |
---|---|---|---|
8RC0-D | 27.1 | 5 | CD2 antigen cytoplasmic tail-binding protein 2 |
3I5X-A | 24.8 | 9.6 | ATP-dependent rna helicase mss116 |
6YVH-K | 24.1 | 1.5 | Pre-mRNA-splicing factor cwc22 homolog |
7NAD-X | 22.9 | 10.4 | 25s rRNA |
3I32-A | 20.1 | 1.9 | Heat resistant rna dependent atpase |
8VX9-B | 19.1 | 6.6 | Hama |
6ZNP-A | 19.1 | 8.9 | Uncharacterized ATP-dependent helicase ypra |
5V9X-A | 18.6 | 9.5 | ATP-dependent dna helicase |
5DCA-A | 18.5 | 7.8 | Pre-mrna-splicing helicase brr2 |
4CGZ-A | 17.7 | 3.5 | Bloom's syndrome helicase |
References
[1] RNA aptamers to initiation factor 4A helicase hinder cap-dependent translation by blocking ATP hydrolysis.Oguro, A., Ohtsu, T., Svitkin, YV., Sonenberg, N., & Nakamura, Y.
RNA, 9(4):394-407. (2003)
[2] NMR structures of double loops of an RNA aptamer against mammalian initiation factor 4A.
Sakamoto, T., Oguro, A., Kawai, G., Ohtsu, T., & Nakamura, Y.
Nucleic Acids Research, 33(2):745-54. (2005)