eIF4A aptamer



Description

In 2003, Nakamura, Y. et al. generated the RNA aptamers 4Apt with high affinity for human eIF4A by SELEX, then confirming the secondary structure. Afterwards, in 2005, Nakamura, Y. et al. determined the solution structure of two essential nucleotide loops (AUCGCA and ACAUAGA) within the aptamer 4Apt using nuclear magnetic resonance (NMR) spectroscopy, and proposed that the AUCGCA loop is directly involved in the interaction with eIF4A[1,2].



SELEX

In 2003, high-affinity RNA aptamers for eIF4A were generated via in vitro RNA selection by Nakamura, Y. et al. These RNAs possess different binding affinities for eIF4A, with dissociation constants ranging from 10 nM to 10 μM.. Representative RNA sequences selected from randomized RNA libraries using different selection procedures. In selection I(+) and I(−), RNAs were selected from N40 pool in the presence and absence of ATP, respectively, via affinity precipitation with Ni-NTA agarose. Selection II and III used N40 and N30 pools, respectively, and RNAs were selected in the absence of ATP via nitrocellulose membrane trapping[1].
Detailed information are accessible on SELEX page.



Structure

2D representation

In the previous SELEX experiment, Aptamer no.21 was islated. Aptamer no.21 showed highest binding affinity to eIF4A among the selected aptamers, the 58 nt core structure of this aptamer is required for efficient recognition of eIF4A. Furthermore, the aptamer binds only to an intact eIF4A, and not to either domain when split at the linker of the ‘dumbbell’ structure. APT58 (58 nt long), a variant of the aptamer no.21 core structure that sustained 4 nt substitutions (G3→A, C6→U, G10→A and C12→U) for NMR analysis[2].

5'-GGAGAUCGCACUCCACAUGUGAGUGAGGCCGAAACAUAGAUUCGACAGGAGGCUCACA-3'

drawing

3D visualisation

Nakamura, Y. et al. determined the solution structure of two essential nucleotide loops (AUCGCA and ACAUAGA) within the aptamer APT58 aptamer using NMR spectroscopy, suggesting that the C7 and C9 of the AUCGCA loop directly interact with eIF4A. Due to the lack of complex structure of 4Apt aptamer and eIF4A. In the AUCGCA loop, C7 and C9 are marked for the directly interacted bases, while ACCGCA loop forms a similar conformation to U-turn motif and that the U-turn like conformation could be important for eIF4A binding without directly interacted bases[2].

Additional available structures that have been solved and detailed information are accessible on Structures page.

(Clicking the "Settings/Controls info" to turn Spin off)      

drawing PDBe Molstar




Binding pocket

Due to the lack of complex structure of APT58 aptamer and eIF4A. Through experiments, it is proved that C7 and C9 are related to the binding of eIF4A. Left: The aptamer in the tertiary structure, it's labeled C7, C9 in orange. Right: eIF4A (shown in vacuumm electrostatics), blue is positive charge, red is negative charge.

drawing drawing


Ligand information

SELEX ligand

The apparent dissociation constant of recombinant eIF4A for some selected RNAs was assessed by a nitrocellulose retention assay in the absence of ATP. The formation of RNA no.21 complexes on the surface-coupled eIF4A was also monitored in the absence of ATP in real time with a BIACORE 2000 instrument based on the surface plasmon resonance (SPR) technique[1].

Name Sequence Ligand Affinity
RNA no.1 5′-GGGAGACAAGAAUAAACGCUCAACAGGCGUUUAGCCUCUAAGUAACAGGGGGCCUCCCAUGAGCUUCGACAGGAGGCUCACAACAGGC-3′ eIF4A 3 μM
RNA no.11 5′-GGGAGACAAGAAUAAACGCUCAAACAUUGCAUCGACAGCUGCAAGGCUCCCGCCGUACAAACCUUCGACAGGAGGCUCACAACAGGC-3′ eIF4A 8 μM
RNA no.20 5′-GGGAGACAAGAAUAAACGCUCAAGGGGACCGCGCCCCACAUGUGAGUGAGGCCGAAACGUAGAUUCGACAGGAGGCUCACAACAGGC-3′ eIF4A 40 nM
RNA no.21 5′-GGGAGACAAGAAUAAACGCUCAAGGGGACCGCGCCCCACAUGUGAGUGAGGCCGAAACAUAGAUUCGACAGGAGGCUCACAACAGGC-3′ eIF4A 27 nM
RNA no.30 5′-GGGAGACAAGAAUAAACGCUCAAUGUGGAUGAUUUGUAUGAUCGCGCAUACAAUUCGACAGGAGGCUCACAACAGGC-3′ eIF4A 1 μM

Structure ligand

ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.-----From Pfam

UniProt ID: uniquely identifies protein sequences in the UniProt database, a resource for protein information.

Pfam: a widely recognised database of protein families and domains.

GenBank: maintained by NCBI(National Center for Biotechnology Information), is a database of nucleotide sequences from various organisms, vital for genetic and molecular biology research.

Mass: an intrinsic property of a body.

Uniprot ID Pfam Mass Protein sequence PDB ID GenBank
P10081 P10081 44.70kDa
GGPYLQ ...... SEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
1FUU 559292
drawing

Similar compound

We used the Dail server website to compare the structural similarities of ligand proteins, and selected the previous information with high similarity for presentation. The Dali server is a network service for comparing protein structures in 3D. Dali compares them against those in the Protein Data Bank (PDB).

Dail server website: a network service for comparing protein structures in 3D. Dali compares them against those in the Protein Data Bank (PDB).

Z-score: a standard score that is converted from an original score. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious.

RMSD: (Root Mean Square Deviation) is used to measure the degree to which atoms deviate from the alignment position.

PDB: PDB ID+ chain name.

PDB Z-score RMSD Description
1FUU-A 44.2 0 Original chain
8RC0-D 27.1 5 CD2 antigen cytoplasmic tail-binding protein 2
3I5X-A 24.8 9.6 ATP-dependent rna helicase mss116
6YVH-K 24.1 1.5 Pre-mRNA-splicing factor cwc22 homolog
7NAD-X 22.9 10.4 25s rRNA
3I32-A 20.1 1.9 Heat resistant rna dependent atpase
8VX9-B 19.1 6.6 Hama
6ZNP-A 19.1 8.9 Uncharacterized ATP-dependent helicase ypra
5V9X-A 18.6 9.5 ATP-dependent dna helicase
5DCA-A 18.5 7.8 Pre-mrna-splicing helicase brr2


References

[1] RNA aptamers to initiation factor 4A helicase hinder cap-dependent translation by blocking ATP hydrolysis.
Oguro, A., Ohtsu, T., Svitkin, YV., Sonenberg, N., & Nakamura, Y.
RNA, 9(4):394-407. (2003)
[2] NMR structures of double loops of an RNA aptamer against mammalian initiation factor 4A.
Sakamoto, T., Oguro, A., Kawai, G., Ohtsu, T., & Nakamura, Y.
Nucleic Acids Research, 33(2):745-54. (2005)